Lab Supply GLP-1 (7-36) with High Purity High Quality And107444-51-9

Model NO.: API Customized: Customized Suitable for: Elderly, Adult Purity: >98% Color: White Type: Vitamins, Amino Acids and Coenzyme Packaging Details: 2mg/Vial 1mg/Vial Trademark: Filter Origin: Shang Hai Powder: Yes Certification: GMP, HSE, ISO 9001, USP, BP State: Solid Appearence: White Powder Grade: Medicine Grade Application: Used Usuage: Animal Pharmaceuticals Specification: 2mg/vial HS Code: 2901291000 Name:GLP-1(7-37), Insulinotropin
Cas No:16941-32-5, 106612-94-6 (net)
Formula: C151H228N40O47
Molecular: 3355.66
Sequence:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG)
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Insulinotropin,Tglp-1, UNII-PI470C66NT, Glp-I (7-37), Glucagon like peptide I (7-37), Glucagon-like peptide 1 (7-37), Glucagon-related peptide (Oncorhynchus kisutch)
 
 
 
Name:GLP-1(7-36), IRP peptide
Cas No: 119637-73-9, 107444-51-9
Formula: C149H226N40O45
Molecular: 3297
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Glp-1a, Glp-I (7-36)amide, Glp-1 (7-36)amide, Glp-I (7-36)NH2, Glucagon-like peptide I (7-36)amide
.   
  
Steriods Main Products List

 

   



 



About
 
Filter is an internationally recognized biochemical manufacturing company thatspecializes in the production of peptide reagents,custom peptides andantibodies is based in Shanghai,China where a 50,000 square foot headquarterand research facility is located.There are 5 manufacturing sites and 2 Research&Development centers that all together total over 350,000 square feet.Weemploy over 1000 science professionals with strong Biotech industrybackgrounds.Our highly qualified staff which includes over 13 years of Filtermanagement experience and our modern facilities allow Filter is to provide highquality,value-added peptide related products.We support today leading medicalresearchers all over the world.
 
 
Products
 
Peptides:custom peptides,catalogue peptides,pharmaceuticalpeptides,Cosmetic Peptides
Antibodies:monoclonal antibody,polyclonal antibody
 
Amino acids and derivates:unnatural amino acids,N-methyl amino acids,Boc-amino acids and derivates,Fmoc-amino acids and derivates,etc
 
 
Custom Peptides
 
Filter is able to produce more than 10,000 purified peptides per month with the help of over 350 synthetic chemists and 250 purification technicians utilizing state-of-the-art highly sophisticated peptide instrumentations.Equipment used includes 400Hz NMR,2 units of FT-IR,10 units of MS,Amino Acid Analyzer,96/102 well automated peptide synthesizers,microwave-assisted peptide synthesizer,200 units of analytical and preparative HPLC.Global market share has been over 60%for research grade peptides.Filter has become the largest and most recognized custom peptide producer worldwide and continues to experience 10%plus growth every year.
 
Contact
Cassie Pan
T:008615294859659
 
 
 
Address:South of Nongye Rd.Zhengdong new District,Zhengzhou




 

Contact us if you need more details on 107444-51-9. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Pharmaceutical Intermediate、Amino Acid. If these products fail to match your need, please contact us and we would like to provide relevant information.

Product Categories : High Purity Peptides