Best Price Glucagon with GMP Lab Supply (10mg/vial)
Basic Info
Model No.: 16941-32-5
Product Description
Model NO.: 16941-32-5 Customized: Non-Customized Suitable for: Adult Purity: >98% Type: Pharmaceutical Intermediate Grade: Medicine Grade Product Name: Glucagon MOQ: 10vials Function: Health Specification: 10mg/vial HS Code: 2801100000 Powder: Yes Certification: GMP, HSE, ISO 9001, USP, BP State: Solid Color: White Storage: Dry Cool Place Certificate: GMP CAS: 16941-32-5 Appearance: White Powder Trademark: Filter Origin: Shanghai Product details:
What is Glucagon Acetate ?
Glucagon is a Peptide Hormone, produced by alpha cells of the pancreas, that raises the concentration of glucose in the bloodstream. Its effect is opposite that of insulin, which lowers the glucose concentration.The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream. High blood glucose levels stimulate the release of insulin. Insulin allows glucose to be taken up and used by insulin-dependent tissues. Thus, glucagon and insulin are part of a feedback system that keeps blood glucose levels at a stable level. Glucagon belongs to a family of several other related hormones.
WHY CHOOSE OUR FILTER?
Contact us if you need more details on Glucagon. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Steriods、Amino Acid. If these products fail to match your need, please contact us and we would like to provide relevant information.
Product Name: | Glucagon |
Synonyms: | GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN |
CAS: | 16941-32-5 |
MF: | C153H225N43O49S |
MW: | 3482.75 |
EINECS: | 232-708-2 |
Product Categories: | Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research |
Purity: | 98%.99% |
Molecular structure |
What is Glucagon Acetate ?
Glucagon is a Peptide Hormone, produced by alpha cells of the pancreas, that raises the concentration of glucose in the bloodstream. Its effect is opposite that of insulin, which lowers the glucose concentration.The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream. High blood glucose levels stimulate the release of insulin. Insulin allows glucose to be taken up and used by insulin-dependent tissues. Thus, glucagon and insulin are part of a feedback system that keeps blood glucose levels at a stable level. Glucagon belongs to a family of several other related hormones.
WHY CHOOSE OUR FILTER?
1. GMP manufacturer |
2. Competitive price and high quality |
3. A powerful peptide manufactory |
4.25years Years of experience in the pharmaceutical and good reputation. |
5. Secure shipping and delivery guaranteed. |
Product Categories : Lab Pharmaceutical Peptide
Premium Related Products
Other Products
Hot Products
Pharmaceutical Peptides Over 98% CAS 77591-33-4 2mg/Vial Thymosin Beta 4 /Tb500Lab Supply GMP Certified Bcp-157 CAS: 137525-51-0 at Hot SaleRaw Powder Deslorelin Acetate for Adult with GMP ApprovedGood Resouce Lanreotide with Raw Powder2016 Hot Sale Factory Price Fast Delivery Pharmaceutical Peptide Melanotan 2 CAS 121062-08-6Selank Lab Supply High Purity 98% Peptides Selank for Research with GMPHigh Quality PT-141 32780-32-8 Peptide for Sexual DysfunctionHigh Purity Carperitide 89213-87-6 with Best PriceGonadorelin Acetate 99%Purity Peptide, Gonadorelin PriceHigh Purity Gh 176-191 for Muscle Growth with GMP (10iu/vial)(Dispel freckle and whiten skin) Peptide Tetrapeptide-30 with GMP CAS 56-81-5Peptide Supply Peptide Product Ghrp6, Top Grade Ghrp6 - Buy Peptide Hormone, CAS 87616-84-0Hot Sale Cjc-1295 for Bodybuilding with GMP SGS (with DAS)Pharmaceutical Intermediate Peptides for Loss Weight 1mg/Vial Igf-1lr3 / MgfResearch Chemical Peptide Ghrp-2 Supplier From ChinaPharmaceutical Peptide Build Muscle/Loss Weight 5mg/Vial Ghrp-2 with Lab Supply