Best Price Glucagon with GMP Lab Supply (10mg/vial)

Model NO.: 16941-32-5 Customized: Non-Customized Suitable for: Adult Purity: >98% Type: Pharmaceutical Intermediate Grade: Medicine Grade Product Name: Glucagon MOQ: 10vials Function: Health Specification: 10mg/vial HS Code: 2801100000 Powder: Yes Certification: GMP, HSE, ISO 9001, USP, BP State: Solid Color: White Storage: Dry Cool Place Certificate: GMP CAS: 16941-32-5 Appearance: White Powder Trademark: Filter Origin: Shanghai Product details:
 
 

Product Name:	Glucagon
Synonyms:	GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS:	16941-32-5
MF:	C153H225N43O49S
MW:	3482.75
EINECS:	232-708-2
Product Categories:	Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research
Purity:	98%.99%
Molecular structure

 
What is Glucagon Acetate ?
 
Glucagon is a Peptide Hormone, produced by alpha cells of the pancreas, that raises the concentration of glucose in the bloodstream. Its effect is opposite that of insulin, which lowers the glucose concentration.The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream. High blood glucose levels stimulate the release of insulin. Insulin allows glucose to be taken up and used by insulin-dependent tissues. Thus, glucagon and insulin are part of a feedback system that keeps blood glucose levels at a stable level. Glucagon belongs to a family of several other related hormones.
 
 

WHY CHOOSE OUR FILTER?

1. GMP manufacturer

2. Competitive price and high quality

3. A powerful peptide manufactory

4.25years Years of experience in the pharmaceutical and good reputation.

5. Secure shipping and delivery guaranteed.

Contact us if you need more details on Glucagon. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Steriods、Amino Acid. If these products fail to match your need, please contact us and we would like to provide relevant information.

Product Categories : Lab Pharmaceutical Peptide