Glucagon Hydrochloride, 16941-32-5, Supply Glucagon Powder
Basic Info
Model No.: API
Product Description
Model NO.: API Customized: Customized Suitable for: Elderly, Adult Purity: >98% Color: White Type: Vitamins, Amino Acids and Coenzyme Packaging Details: 2mg/Vial 1mg/Vial Trademark: Filter Origin: Shang Hai Powder: Yes Certification: GMP, HSE, ISO 9001, USP, BP State: Solid Appearence: White Powder Grade: Medicine Grade Application: Used Usuage: Animal Pharmaceuticals Specification: 2mg/vial HS Code: 2901291000
.
About
Filter is an internationally recognized biochemical manufacturing company thatspecializes in the production of peptide reagents,custom peptides andantibodies is based in Shanghai,China where a 50,000 square foot headquarterand research facility is located.There are 5 manufacturing sites and 2 Research&Development centers that all together total over 350,000 square feet.Weemploy over 1000 science professionals with strong Biotech industrybackgrounds.Our highly qualified staff which includes over 13 years of Filtermanagement experience and our modern facilities allow Filter is to provide highquality,value-added peptide related products.We support today leading medicalresearchers all over the world.
Products
Peptides:custom peptides,catalogue peptides,pharmaceuticalpeptides,Cosmetic Peptides
Antibodies:monoclonal antibody,polyclonal antibody
Amino acids and derivates:unnatural amino acids,N-methyl amino acids,Boc-amino acids and derivates,Fmoc-amino acids and derivates,etc
Custom Peptides
Filter is able to produce more than 10,000 purified peptides per month with the help of over 350 synthetic chemists and 250 purification technicians utilizing state-of-the-art highly sophisticated peptide instrumentations.Equipment used includes 400Hz NMR,2 units of FT-IR,10 units of MS,Amino Acid Analyzer,96/102 well automated peptide synthesizers,microwave-assisted peptide synthesizer,200 units of analytical and preparative HPLC.Global market share has been over 60%for research grade peptides.Filter has become the largest and most recognized custom peptide producer worldwide and continues to experience 10%plus growth every year.
Contact
Cassie Pan
T:008615294859659
Address:South of Nongye Rd.Zhengdong new District,Zhengzhou
Contact us if you need more details on 16941-32-5. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Pharmaceutical Intermediate、Amino Acid. If these products fail to match your need, please contact us and we would like to provide relevant information.
Product Name: | Glucagon |
Synonyms: | GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN |
CAS: | 16941-32-5 |
MF: | C153H225N43O49S |
MW: | 3482.75 |
EINECS: | 232-708-2 |
Product Categories: | Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research |
Purity: | 98%.99% |
Molecular structure |
About
Filter is an internationally recognized biochemical manufacturing company thatspecializes in the production of peptide reagents,custom peptides andantibodies is based in Shanghai,China where a 50,000 square foot headquarterand research facility is located.There are 5 manufacturing sites and 2 Research&Development centers that all together total over 350,000 square feet.Weemploy over 1000 science professionals with strong Biotech industrybackgrounds.Our highly qualified staff which includes over 13 years of Filtermanagement experience and our modern facilities allow Filter is to provide highquality,value-added peptide related products.We support today leading medicalresearchers all over the world.
Products
Peptides:custom peptides,catalogue peptides,pharmaceuticalpeptides,Cosmetic Peptides
Antibodies:monoclonal antibody,polyclonal antibody
Amino acids and derivates:unnatural amino acids,N-methyl amino acids,Boc-amino acids and derivates,Fmoc-amino acids and derivates,etc
Custom Peptides
Filter is able to produce more than 10,000 purified peptides per month with the help of over 350 synthetic chemists and 250 purification technicians utilizing state-of-the-art highly sophisticated peptide instrumentations.Equipment used includes 400Hz NMR,2 units of FT-IR,10 units of MS,Amino Acid Analyzer,96/102 well automated peptide synthesizers,microwave-assisted peptide synthesizer,200 units of analytical and preparative HPLC.Global market share has been over 60%for research grade peptides.Filter has become the largest and most recognized custom peptide producer worldwide and continues to experience 10%plus growth every year.
Contact
Cassie Pan
T:008615294859659
Address:South of Nongye Rd.Zhengdong new District,Zhengzhou
Contact us if you need more details on 16941-32-5. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Pharmaceutical Intermediate、Amino Acid. If these products fail to match your need, please contact us and we would like to provide relevant information.
Product Categories : Pharmaceutical Peptides
Other Products
Hot Products
Pharmaceutical Peptides Over 98% CAS 77591-33-4 2mg/Vial Thymosin Beta 4 /Tb500Lab Supply GMP Certified Bcp-157 CAS: 137525-51-0 at Hot SaleRaw Powder Deslorelin Acetate for Adult with GMP ApprovedGood Resouce Lanreotide with Raw Powder2016 Hot Sale Factory Price Fast Delivery Pharmaceutical Peptide Melanotan 2 CAS 121062-08-6Selank Lab Supply High Purity 98% Peptides Selank for Research with GMPHigh Quality PT-141 32780-32-8 Peptide for Sexual DysfunctionHigh Purity Carperitide 89213-87-6 with Best PriceGonadorelin Acetate 99%Purity Peptide, Gonadorelin PriceHigh Purity Gh 176-191 for Muscle Growth with GMP (10iu/vial)(Dispel freckle and whiten skin) Peptide Tetrapeptide-30 with GMP CAS 56-81-5Peptide Supply Peptide Product Ghrp6, Top Grade Ghrp6 - Buy Peptide Hormone, CAS 87616-84-0Hot Sale Cjc-1295 for Bodybuilding with GMP SGS (with DAS)Pharmaceutical Intermediate Peptides for Loss Weight 1mg/Vial Igf-1lr3 / MgfResearch Chemical Peptide Ghrp-2 Supplier From ChinaPharmaceutical Peptide Build Muscle/Loss Weight 5mg/Vial Ghrp-2 with Lab Supply