Find Pharmaceutical Peptides , Pharmaceutical Intermediate, Amino Acid on Industry Directory, Reliable Manufacturer/Supplier/Factory from China.

Inquiry Basket (0)
Home > Products > Pharmaceutical Peptides > Chinese Peptides Mod Grf (1-29) with 2mg

Chinese Peptides Mod Grf (1-29) with 2mg

Basic Info

Model No.:  API

Product Description



Model NO.: API


Customized: Customized


Suitable for: Adult


Purity: >98%


Appearance: Powder


Storage: -18


Trademark: Filter


Specification: iu, mg, g


HS Code: 3002200000




Powder: Yes


Certification: GMP


State: Powder


Colour: White


Brand: Filter


CAS: 863288-34-0


Transport Package: Bottled


Origin: Shanghai


CJC-1295 without DAC(CJC-1293)

CJC-1295 without DAC (CJC-1293), a 29- Amino Acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively which can make the peptide more stable. One of its advantages over traditional GHRH is its ability to bioconjugate with serum albumin, thus increasing its half-life and therapeutic window. It accomplishes this by using protecting groups around the Amino Acids of GHRH typically susceptible to enzymatic degradation.

Product Name CJC-1295 without DAC(CJC-1293)
Place of origin China
Routine use of storage 2-8ºC
Cycle-time 3-7days
Purity 98%min
Brand Name Filter
Valid Date 2years
Delivery Date In 7 days




Products List:

NO. Name Purity CAS
1 Abarelix Acetate 98% 183552-38-7
2 Alarelin Acetate 98% 79561-22-1
3 Angiotensin Acetate 98% 58-49-1
4 Angiotensin II 98% 68521-88-0
5 Antide Acetate 98% 112568-12-4
6 Argpressin Acetate 98% 113-79-1
7 Argreline Acetate 98% 616204-22-9
8 Atosiban Acetate 98% 90779-69-4
9 Aviptadil Acetate 98% 40077-57-4
10 Bate-Amyloid(1-42)human 95% 107761-42-2
11 Bivalirudin Trifluoroacetate 98% 128270-60-0
12 Buserelin acetate 98% 57982-77-1
13 Calcuitonin 9007/12/9
14 Carbetocin Acetate 98% 37025-55-1
15 Carperitide 98% 89213-87-6
16 Cerropin B 98%
17 Cetrorelix Acetate 98% 130143-01-0
18 Cetrorelix Acetate 98% 130143-01-0
19 CJC-1295 98% 863288-34-0
20 Copper Peptide(GHK-Cu) 98% 49557-75-7
21 CRF (human, rat) Acetate 98% 86784-80-7
22 CRF (ovine) Trifluoroacetate 98% 79804-71-0
23 Deslorelin Acetate 98% 57773-65-6
24 Desmopressin Acetate 98% 16679-58-6
25 Dynorphin A (1-13) Acetate 98% 72957-38-1
26 Elcatonin Acetate 98% 60731-46-6
27 Eledoisin Acetate 98% 69-25-0
28 Endothelin-1 Acetate 98% 117399-94-7
29 Enfuvirtide Acetate (T-20) 95% 159519-65-0
30 Eptifibatide Acetate 98% 148031-34-9/188627-80-7
31 Exenatide Acetate 98% 141732-76-5
32 Felypressin Acetate 98% 56-59-7
33 Fertirelin Acetate 98% 38234-21-8
34 Ganirelix Acetate 98% 123246-29-7
35 GHRP-2 Acetate 98% 158861-67-7
36 GHRP-6 Acetate 98% 87616-84-0
37 Glatiramer Acetate 99% 147245-92-9
38 GLP(7-36) 98% 107444-51-9
39 GLP-1 (7-37) Acetate 98% 106612-94-6
40 Glucagon Hydrochloride 98% 16941-32-5
41 Gonadorelin Acetate 98% 34973-08-5
42 Goserelin Acetate 98% 145781-92-6
43 GRF (human) Acetate 98% 83930-13-6
44 Hexarelin Acetate 98% 140703-51-1
45 Histrelin Acetate 98% 76712-82-8
46 Icatibant Acetate 98% 30308-48-4
47 Lanreotide 98% 108736-35-2
48 Lecirelin (Dalmarelin) Acetate 98% 61012-19-9
49 Leuprolide 98% 74381-53-6
50 Leuprorelin Acetate 98% 53714-56-0
51 Linaclotide Acatate 98% 851199-59-2
52 Lixisenatide 98% 320367-13-3
53 Lraglutide 98% 204656-20-2
54 Lysipressin Acetate 98% 50-57-7
55 Melanotan II Acetate 98% 121062-08-6
56 MOG(35-55) 98% 163913-87-9
57 Nafarelin Acetate 98% 76932-56-4
58 Nesiritide Acetate (BNP-32) 98% 114471-18-0
59 Octreotide 98% 79517-01-4
60 Ornipressin Acetate 98% 3397-23-7
61 Oxytocin Acetate 98% 50-56-6
62 Palmitoyl Pentapeptide 98% 214047-00-4
63 Pexiganan 98% 147664-63-9
64 Pramlintide Acetate 98% 196078-30-5
65 Pretirelin
66 PT141 Acetate 98% 32780-32-8
67 Salmon Calcitonin Acetate 98% 47931-85-1
68 Secretin Acetate 98% 10813-74-8
69 Sermorelin Aceta 98% 86168-78-7
70 Sincalide 98% 25126-32-3
71 Somatostatin Acetate 98% 38916-34-6
72 Splenopentin Acetate 98% 105184-37-0
73 Taltirelin Acetate 98% 103300-74-9
74 Teriparatide Acetate 98% 52232-67-4
75 Teriparatide Acetate 98% 52232-67-4
76 Terlipressin Acetate 98% 14636-12-5
77 Tetracosactide Acetate 98% 16960-16-0
78 Thymalfasin 98% 62304-98-7
79 Thymopentin 98% 69558-55-0
80 Thymosin α1 Acetate 98% 14636-12-5
81 Thymosin β4 Acetate 98% 77591-33-4
82 Triptorelin Acetate 98% 57773-63-4
83 Vapreotide Acetate 98% 103222-11-3
84 Vasopressin Acetate 98% 9034-50-8
85 Ziconotide Acetate 98% 107452-89-1














Contact us if you need more details on Chinese Peptides Mod Grf with 2mg. We are ready to answer your questions on packaging, logistics, certification or any other aspects about China Peptides、China Research Chemical. If these products fail to match your need, please contact us and we would like to provide relevant information.

Product Categories : Pharmaceutical Peptides