Chinese Peptides Mod Grf (1-29) with 2mg
Basic Info
Model No.: API
Product Description
Model NO.: API
Customized: Customized
Suitable for: Adult
Purity: >98%
Appearance: Powder
Storage: -18
Trademark: Filter
Specification: iu, mg, g
HS Code: 3002200000
Powder: Yes
Certification: GMP
State: Powder
Colour: White
Brand: Filter
CAS: 863288-34-0
Transport Package: Bottled
Origin: Shanghai
CJC-1295 without DAC(CJC-1293)
CJC-1295 without DAC (CJC-1293), a 29- Amino Acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide analogue of GHRH with D-Ala, Gln, Ala, and Leu substitutions at positions 2, 8, 15, and 27 respectively which can make the peptide more stable. One of its advantages over traditional GHRH is its ability to bioconjugate with serum albumin, thus increasing its half-life and therapeutic window. It accomplishes this by using protecting groups around the Amino Acids of GHRH typically susceptible to enzymatic degradation.
Product Name | CJC-1295 without DAC(CJC-1293) |
Place of origin | China |
Routine use of storage | 2-8ºC |
Cycle-time | 3-7days |
Purity | 98%min |
Brand Name | Filter |
Valid Date | 2years |
Delivery Date | In 7 days |
Products List:
NO. | Name | Purity | CAS |
1 | Abarelix Acetate | 98% | 183552-38-7 |
2 | Alarelin Acetate | 98% | 79561-22-1 |
3 | Angiotensin Acetate | 98% | 58-49-1 |
4 | Angiotensin II | 98% | 68521-88-0 |
5 | Antide Acetate | 98% | 112568-12-4 |
6 | Argpressin Acetate | 98% | 113-79-1 |
7 | Argreline Acetate | 98% | 616204-22-9 |
8 | Atosiban Acetate | 98% | 90779-69-4 |
9 | Aviptadil Acetate | 98% | 40077-57-4 |
10 | Bate-Amyloid(1-42)human | 95% | 107761-42-2 |
11 | Bivalirudin Trifluoroacetate | 98% | 128270-60-0 |
12 | Buserelin acetate | 98% | 57982-77-1 |
13 | Calcuitonin | 9007/12/9 | |
14 | Carbetocin Acetate | 98% | 37025-55-1 |
15 | Carperitide | 98% | 89213-87-6 |
16 | Cerropin B | 98% | |
17 | Cetrorelix Acetate | 98% | 130143-01-0 |
18 | Cetrorelix Acetate | 98% | 130143-01-0 |
19 | CJC-1295 | 98% | 863288-34-0 |
20 | Copper Peptide(GHK-Cu) | 98% | 49557-75-7 |
21 | CRF (human, rat) Acetate | 98% | 86784-80-7 |
22 | CRF (ovine) Trifluoroacetate | 98% | 79804-71-0 |
23 | Deslorelin Acetate | 98% | 57773-65-6 |
24 | Desmopressin Acetate | 98% | 16679-58-6 |
25 | Dynorphin A (1-13) Acetate | 98% | 72957-38-1 |
26 | Elcatonin Acetate | 98% | 60731-46-6 |
27 | Eledoisin Acetate | 98% | 69-25-0 |
28 | Endothelin-1 Acetate | 98% | 117399-94-7 |
29 | Enfuvirtide Acetate (T-20) | 95% | 159519-65-0 |
30 | Eptifibatide Acetate | 98% | 148031-34-9/188627-80-7 |
31 | Exenatide Acetate | 98% | 141732-76-5 |
32 | Felypressin Acetate | 98% | 56-59-7 |
33 | Fertirelin Acetate | 98% | 38234-21-8 |
34 | Ganirelix Acetate | 98% | 123246-29-7 |
35 | GHRP-2 Acetate | 98% | 158861-67-7 |
36 | GHRP-6 Acetate | 98% | 87616-84-0 |
37 | Glatiramer Acetate | 99% | 147245-92-9 |
38 | GLP(7-36) | 98% | 107444-51-9 |
39 | GLP-1 (7-37) Acetate | 98% | 106612-94-6 |
40 | Glucagon Hydrochloride | 98% | 16941-32-5 |
41 | Gonadorelin Acetate | 98% | 34973-08-5 |
42 | Goserelin Acetate | 98% | 145781-92-6 |
43 | GRF (human) Acetate | 98% | 83930-13-6 |
44 | Hexarelin Acetate | 98% | 140703-51-1 |
45 | Histrelin Acetate | 98% | 76712-82-8 |
46 | Icatibant Acetate | 98% | 30308-48-4 |
47 | Lanreotide | 98% | 108736-35-2 |
48 | Lecirelin (Dalmarelin) Acetate | 98% | 61012-19-9 |
49 | Leuprolide | 98% | 74381-53-6 |
50 | Leuprorelin Acetate | 98% | 53714-56-0 |
51 | Linaclotide Acatate | 98% | 851199-59-2 |
52 | Lixisenatide | 98% | 320367-13-3 |
53 | Lraglutide | 98% | 204656-20-2 |
54 | Lysipressin Acetate | 98% | 50-57-7 |
55 | Melanotan II Acetate | 98% | 121062-08-6 |
56 | MOG(35-55) | 98% | 163913-87-9 |
57 | Nafarelin Acetate | 98% | 76932-56-4 |
58 | Nesiritide Acetate (BNP-32) | 98% | 114471-18-0 |
59 | Octreotide | 98% | 79517-01-4 |
60 | Ornipressin Acetate | 98% | 3397-23-7 |
61 | Oxytocin Acetate | 98% | 50-56-6 |
62 | Palmitoyl Pentapeptide | 98% | 214047-00-4 |
63 | Pexiganan | 98% | 147664-63-9 |
64 | Pramlintide Acetate | 98% | 196078-30-5 |
65 | Pretirelin | ||
66 | PT141 Acetate | 98% | 32780-32-8 |
67 | Salmon Calcitonin Acetate | 98% | 47931-85-1 |
68 | Secretin Acetate | 98% | 10813-74-8 |
69 | Sermorelin Aceta | 98% | 86168-78-7 |
70 | Sincalide | 98% | 25126-32-3 |
71 | Somatostatin Acetate | 98% | 38916-34-6 |
72 | Splenopentin Acetate | 98% | 105184-37-0 |
73 | Taltirelin Acetate | 98% | 103300-74-9 |
74 | Teriparatide Acetate | 98% | 52232-67-4 |
75 | Teriparatide Acetate | 98% | 52232-67-4 |
76 | Terlipressin Acetate | 98% | 14636-12-5 |
77 | Tetracosactide Acetate | 98% | 16960-16-0 |
78 | Thymalfasin | 98% | 62304-98-7 |
79 | Thymopentin | 98% | 69558-55-0 |
80 | Thymosin α1 Acetate | 98% | 14636-12-5 |
81 | Thymosin β4 Acetate | 98% | 77591-33-4 |
82 | Triptorelin Acetate | 98% | 57773-63-4 |
83 | Vapreotide Acetate | 98% | 103222-11-3 |
84 | Vasopressin Acetate | 98% | 9034-50-8 |
85 | Ziconotide Acetate | 98% | 107452-89-1 |
Contact us if you need more details on Chinese Peptides Mod Grf with 2mg. We are ready to answer your questions on packaging, logistics, certification or any other aspects about China Peptides、China Research Chemical. If these products fail to match your need, please contact us and we would like to provide relevant information.
Product Categories : Pharmaceutical Peptides
Other Products
Hot Products
Pharmaceutical Peptides Over 98% CAS 77591-33-4 2mg/Vial Thymosin Beta 4 /Tb500Lab Supply GMP Certified Bcp-157 CAS: 137525-51-0 at Hot SaleRaw Powder Deslorelin Acetate for Adult with GMP ApprovedGood Resouce Lanreotide with Raw Powder2016 Hot Sale Factory Price Fast Delivery Pharmaceutical Peptide Melanotan 2 CAS 121062-08-6Selank Lab Supply High Purity 98% Peptides Selank for Research with GMPHigh Quality PT-141 32780-32-8 Peptide for Sexual DysfunctionHigh Purity Carperitide 89213-87-6 with Best PriceGonadorelin Acetate 99%Purity Peptide, Gonadorelin PriceHigh Purity Gh 176-191 for Muscle Growth with GMP (10iu/vial)(Dispel freckle and whiten skin) Peptide Tetrapeptide-30 with GMP CAS 56-81-5Peptide Supply Peptide Product Ghrp6, Top Grade Ghrp6 - Buy Peptide Hormone, CAS 87616-84-0Hot Sale Cjc-1295 for Bodybuilding with GMP SGS (with DAS)Pharmaceutical Intermediate Peptides for Loss Weight 1mg/Vial Igf-1lr3 / MgfResearch Chemical Peptide Ghrp-2 Supplier From ChinaPharmaceutical Peptide Build Muscle/Loss Weight 5mg/Vial Ghrp-2 with Lab Supply