Lab Supply Pharmaceutical Intermediate GLP (7-36) for Insulin Secretagogue
Basic Info
Model No.: 107444-51-9
Product Description
Model NO.: 107444-51-9 Customized: Customized Suitable for: Lab Research Purity: >98% Application: Pharmaceutical Appearance: Lyophilized Powder Specification: iu, mg, g, kg HS Code: 3004905910 Powder: Yes Certification: GMP State: Solid Product Name: GLP(7-36) Color: White Trademark: Filter Origin: Shanghai Lab Supply Pharmaceutical Intermediate GLP (7-36) for Insulin Secretagogue
Description
GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Our process:
The quality control process
1)Purchasing
Thorough market research, understand the price of raw materials and performance.To the procurement source to understand fully, and fully guarantee the quality of the procurement of raw materials.
2) Inspection
Four steps: sampling, sample pretreatment, measuring and data processing.
3) Producing
a)Each operator must do self-inspection of producs and make the corresponding inspection records.
b)Full-time inspectors through check the operator self-inspection, and review and sign in the corresponding record. Full-time inspection is responsible for inspection of finished product, and make the finished product incoming inspection records.
4) Before selling
Test result can be provided before selling.
Third-party detection institution is allowed if you are not satisfied with test results.
Our advantages:
1. Quality:
Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.
And we are the manufactory, so no problem for us to control the quality.
2.Payment method: Western Union,TT.
3.Service: Best service with after-sales service to all clients.
4.Delivery:
Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.
Other Peptide Our Lab Supply:
Contact us if you need more details on Neuropeptide. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Glucagon-Like Peptide (7-36)、107444-51-9. If these products fail to match your need, please contact us and we would like to provide relevant information.
Description
| Product Name: | GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN |
| Synonyms: | PREPROGLUCAGON (98-127) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT;PREPROGLUCAGON 78-107 AMIDE;PREPROGLUCAGON (78-107) AMIDE (HUMAN);PROGLUCAGON (78-107) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT;glucagon-likepeptidei(7-36;HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| CAS: | 107444-51-9 |
| MF: | C149H226N40O45 |
| MW: | 3297.63 |
| EINECS: | |
| Product Categories: | Peptide;Glucagon receptor and related |
| Mol File: | 107444-51-9.mol |
GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Our process:
The quality control process
1)Purchasing
Thorough market research, understand the price of raw materials and performance.To the procurement source to understand fully, and fully guarantee the quality of the procurement of raw materials.
2) Inspection
Four steps: sampling, sample pretreatment, measuring and data processing.
3) Producing
a)Each operator must do self-inspection of producs and make the corresponding inspection records.
b)Full-time inspectors through check the operator self-inspection, and review and sign in the corresponding record. Full-time inspection is responsible for inspection of finished product, and make the finished product incoming inspection records.
4) Before selling
Test result can be provided before selling.
Third-party detection institution is allowed if you are not satisfied with test results.
Our advantages:
1. Quality:
Our company is a professional production of hormone intermediates for many years, our products have exported to Germany,Spain, UK, USA, Australia, Middle East, and so on other country, and we have got very good feedback from our customers, you can trust us.
And we are the manufactory, so no problem for us to control the quality.
2.Payment method: Western Union,TT.
3.Service: Best service with after-sales service to all clients.
4.Delivery:
Sample Order :Package will be shipped with 3days after payment. We can send it via UP, EMS, HK Air Post, DHL or othermethod. We have a professional and stable logistics, and we can deliver the package smoothly around 3 to 5 days.
Other Peptide Our Lab Supply:
| Product | Purity | CAS No. |
| Abarelix Acetate | 98% | 183552-38-7 |
| Alarelin Acetate | 98% | 79561-22-1 |
| Angiotensin Acetate | 98% | 58-49-1 |
| Angiotensin II | 98% | 68521-88-0 |
| Antide Acetate | 98% | 112568-12-4 |
| Argpressin Acetate | 98% | 113-79-1 |
| Argreline Acetate | 98% | 616204-22-9 |
| Atosiban Acetate | 98% | 90779-69-4 |
| Aviptadil Acetate | 98% | 40077-57-4 |
| Bate-Amyloid(1-42)human | 95% | 107761-42-2 |
| Bivalirudin Trifluoroacetate | 98% | 128270-60-0 |
| Buserelin acetate | 98% | 57982-77-1 |
| Calcitonin | 9007/12/9 | |
| Carbetocin Acetate | 98% | 37025-55-1 |
| Carperitide | 98% | 89213-87-6 |
| Cecropin B | 98% | |
| Cetrorelix Acetate | 98% | 130143-01-0 |
| Cetrorelix Acetate | 98% | 130143-01-0 |
| CJC-1295 | 98% | 863288-34-0 |
| Copper Peptide(GHK-Cu) | 98% | 49557-75-7 |
| CRF (human, rat) Acetate | 98% | 86784-80-7 |
| CRF (ovine) Trifluoroacetate | 98% | 79804-71-0 |
| Deslorelin Acetate | 98% | 57773-65-6 |
| Desmopressin Acetate | 98% | 16679-58-6 |
| Dynorphin A (1-13) Acetate | 98% | 72957-38-1 |
| Elcatonin Acetate | 98% | 60731-46-6 |
| Eledoisin Acetate | 98% | 69-25-0 |
| Endothelin-1 Acetate | 98% | 117399-94-7 |
| Enfuvirtide Acetate (T-20) | 95% | 159519-65-0 |
| Eptifibatide Acetate | 98% | 148031-34-9/188627-80-7 |
| Exenatide Acetate | 98% | 141732-76-5 |
| Felypressin Acetate | 98% | 56-59-7 |
| Fertirelin Acetate | 98% | 38234-21-8 |
| Ganirelix acetate | 98% | 123246-29-7 |
| GHRP-2 Acetate | 98% | 158861-67-7 |
| GHRP-6 Acetate | 98% | 87616-84-0 |
| Glatiramer Acetate | 99% | 147245-92-9 |
| GLP(7-36) | 98% | 107444-51-9 |
| GLP-1 (7-37) Acetate | 98% | 106612-94-6 |
Product Categories : Pharmaceutical Intermediate
Premium Related Products
Other Products
Hot Products
Pharmaceutical Peptides Over 98% CAS 77591-33-4 2mg/Vial Thymosin Beta 4 /Tb500Lab Supply GMP Certified Bcp-157 CAS: 137525-51-0 at Hot SaleRaw Powder Deslorelin Acetate for Adult with GMP ApprovedGood Resouce Lanreotide with Raw Powder2016 Hot Sale Factory Price Fast Delivery Pharmaceutical Peptide Melanotan 2 CAS 121062-08-6Selank Lab Supply High Purity 98% Peptides Selank for Research with GMPHigh Quality PT-141 32780-32-8 Peptide for Sexual DysfunctionHigh Purity Carperitide 89213-87-6 with Best PriceGonadorelin Acetate 99%Purity Peptide, Gonadorelin PriceHigh Purity Gh 176-191 for Muscle Growth with GMP (10iu/vial)(Dispel freckle and whiten skin) Peptide Tetrapeptide-30 with GMP CAS 56-81-5Peptide Supply Peptide Product Ghrp6, Top Grade Ghrp6 - Buy Peptide Hormone, CAS 87616-84-0Hot Sale Cjc-1295 for Bodybuilding with GMP SGS (with DAS)Pharmaceutical Intermediate Peptides for Loss Weight 1mg/Vial Igf-1lr3 / MgfResearch Chemical Peptide Ghrp-2 Supplier From ChinaPharmaceutical Peptide Build Muscle/Loss Weight 5mg/Vial Ghrp-2 with Lab Supply