Pharmaceutical Intermediate Peptide Glucagon Hydrochloride CAS 16941-32-5

Model NO.: 16941-32-5 Customized: Customized Suitable for: Adult Purity: >98% Appearance: Frozen Powder Brand: Filter Transport Package: Plastic, Tube, Box, Icebag Origin: China Powder: Yes Certification: GMP, HSE, ISO 9001, USP, BP State: Powder Storage: Cool Dry Place Color: White Trademark: Filter Specification: 10iu/vial HS Code: 3001200090 Product Name: Glucagon Acetate
 
 

Product Name:	Glucagon
Synonyms:	GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS:	16941-32-5
MF:	C153H225N43O49S
MW:	3482.75
EINECS:	232-708-2
Product Categories:	Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research
Purity:	98%.99%
Molecular structure

 
 
 
What is Glucagon Acetate ?
 
Glucagon is a Peptide Hormone, produced by alpha cells of the pancreas, that raises the concentration of glucose in the bloodstream. Its effect is opposite that of insulin, which lowers the glucose concentration.The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream. High blood glucose levels stimulate the release of insulin. Insulin allows glucose to be taken up and used by insulin-dependent tissues. Thus, glucagon and insulin are part of a feedback system that keeps blood glucose levels at a stable level. Glucagon belongs to a family of several other related hormones.


----------Additional Information  ------------
Brand: Filter
Package:Plastic Tube
Place of origin:China
Certificate: GMP
Port:Shanghai,Guangzhou,Shenzhen,HongKong

-----------Delivery Information  -------------
Packing : Plastic Tube/vials or as your request
Payment : T/T, Western Union
Port : Shanghai, Shenzhen,Gunagzhou Hongkong
Shipment method : EMS,TNT, DHL, FeDex, UPS, etc
Leading  time : Within 24 hours after payment
Delivery time : safe & timely, around 3 days after payment.

----------Our Competitive Advantages  -----------
1.Rich experience.
Our company is a professional production leading factory in China in pharmaceutical area of many years
2.Superior quality, purity and favourable.
Our company is a professional leading manufacturer in China in pharmaceutical area.Good quality is one of our secret success.
3.Safe and fast delivery.
We have GOLDEN FORWARDER and UK Warehouse  so we can delivery quickly and safely.
4.Package: Professional packing with professional materials.
5.Competitive Prices : Low price with high qulity.

                                                   Peptide  List
 

Product Name	Purity	Specification
Enfuvirtide Acetate (T-20)	98%min	10mg/vial,  10vial/kit
GHRP-2	98%min	5mg/vial,  10vial/kit
GHRP-6	98%min	5mg/vial,  10vial/kit
CJC-1295without DAC(CJC-1293)	98%min	2mg/vial,  10vial/kit
CJC-1295 (DAC)	98%min	2mg/vial,  10vial/kit
Sermorelin Acetate	98%min	2mg/vial,  10vial/kit
Thymopentin	98%min	5mg/vial,  10vial/kit
Dynorphin A (1-13) Acetate	98%min	10mg/vial,  10vial/kit
PT-141	98%min	10mg/vial,  10vial/kit
Hexarelin	98%min	2mg/vial,  10vial/kit
MT-II (Melanotan II )	98%min	10mg/vial,  10vial/kit
Sermorelin Aceta	98%min	2mg/vial,  10vial/kit
Ipamorealin	98%min	2mg/vial,  10vial/kit
TB-500(Thymosin β4 Acetate)	98%min	2mg/vial,5mg/vial,10mg/vial, 10vial/kit

No.	Name	Purity	CAS No.
1	Abarelix Acetate	98%	183552-38-7
2	Alarelin Acetate	98%	79561-22-1
3	Angiotensin Acetate	98%	58-49-1
4	Angiotensin II	98%	68521-88-0
5	Antide Acetate	98%	112568-12-4
6	Argpressin Acetate	98%	113-79-1
7	Argreline Acetate	98%	616204-22-9
8	Atosiban Acetate	98%	90779-69-4
9	Aviptadil Acetate	98%	40077-57-4
10	Bate-Amyloid(1-42)human	95%	107761-42-2
11	Bivalirudin Trifluoroacetate	98%	128270-60-0
12	Buserelin acetate	98%	57982-77-1
13	Calcitonin		9007/12/9
14	Carbetocin Acetate	98%	37025-55-1
15	Carperitide	98%	89213-87-6
16	Cerropin B	98%
17	Cetrorelix Acetate	98%	130143-01-0
18	Cetrorelix Acetate	98%	130143-01-0
19	CJC-1295	98%	863288-34-0
20	Copper Peptide(GHK-Cu)	98%	49557-75-7

Should any interest on any of the above peptides, welcome to contact us.

Contact us if you need more details on Glucagon Hydrochloride. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Lab Supply Glucagon Hydrochloride、Peptide Glucagon Hydrochloride. If these products fail to match your need, please contact us and we would like to provide relevant information.

Product Categories : Pharmaceutical Intermediate