High Purity Powder GLP-1 (7~36) CAS: 107444-51-9

Model NO.: API Appearance: Powder Colour: White Color: White Application: Used Trademark: Filter Origin: Shang Hai Type: Pharmaceutical Intermediates Quality: Technical Appearence: White Powder Grade: Medicine Grade Packaging Details: 2mg/Vial 1mg/Vial Specification: 2mg/vial HS Code: 2901291000 Name:GLP-1(7-37), Insulinotropin
Cas No:16941-32-5, 106612-94-6 (net)
Formula: C151H228N40O47
Molecular: 3355.66
Sequence:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly(HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG)
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Insulinotropin,Tglp-1, UNII-PI470C66NT, Glp-I (7-37), Glucagon like peptide I (7-37), Glucagon-like peptide 1 (7-37), Glucagon-related peptide (Oncorhynchus kisutch)
 
 
 
Name:GLP-1(7-36), IRP peptide
Cas No: 119637-73-9, 107444-51-9
Formula: C149H226N40O45
Molecular: 3297
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Glp-1a, Glp-I (7-36)amide, Glp-1 (7-36)amide, Glp-I (7-36)NH2, Glucagon-like peptide I (7-36)amide
 
 
Others:  
Payment: T/T,PayPal,Western Union,MoneyGram,L/C,ESCROW
Delivery time : Around 3-5 working days after your payment.
In stock: Yes
Capacity: bulk
Reference price: please inquiry
Sample: please inquiry
Guarantee: Full refund if you met any quality problem
Packing Detail: 1g/bottle or according to your request
Storage Situation: sealed, keep it in refrigerator at 2-8 degrees Celsius
Shelf Life: Two years
 

Contact us if you need more details on Enfuvirtide. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Pharmaceutical Intermediate、GLP-1 Agonist. If these products fail to match your need, please contact us and we would like to provide relevant information.

Product Categories : High Purity Peptides