Find 7-37-Glucagon-like Peptid Human 106612-94-6, High Purity Human GLP-1 7-37 CAS 106612-94-6, Pharmaceutical Raw Material GLP-1 Acetate on Industry Directory, Reliable Manufacturer/Supplier/Factory from China.

Inquiry Basket (0)
Home > Products > High Purity Peptides > High Purity 98% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6

High Purity 98% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6

High Purity 98% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6

    Payment Type: T/T
    Terms of Trade: CIF
    Min. Order: 1 Kilogram
    Delivery Time: 15 Days
    Packaging: AS REQUIRED
    Productivity: KGS
    Brand: VOLSENCHEM
    Transportation: Air
    Place of Origin: CHINA
    Supply Ability: TRUE MANUFACTURER
    Certificate: GMP Peptide

Basic Info

Model No.: 106612-94-6

Product Description

We offer great quality and High Purity GLP-1 CAS 106612-94-6. Glucagon like peptide -1 (GLP-1) is a brain gut peptides secretion ileal endocrine cells, at present mainly as a target for type 2 diabetes drug action. The advantage of GLP-1 CAS 106612-94-6 can reduce the inhibition of gastric emptying, intestinal peristalsis. This provides a very good prospect for the treatment of type 2 diabetes mellitus. But because GLP-1 is a polypeptide, cannot be administered orally is a major shortcoming. We are skillful to produce high purity GLP-1. We can provide different packaging to meet customers requirement.


Thera. Category: Pharmaceutical Peptide

Cas No.: 106612-94-6

Synonyms: PROGLUCAGON (78-108) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);PREPROGLUCAGON 78-108 HUMAN;PREPROGLUCAGON (98-128) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);INSULINOTROPIN (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG;GLP-1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG)

106612-94-6

Molecular Formula: C151H228N40O47

Molecular Weight: 3355.67

Purity: ≥98%

Packing: Export worthy packing

Material Safety Data Sheet: Available on request

Usage: used as a paracrine hormone involved in the inhibition of glucagon

Taizhou Volsen Chemical Co., Ltd.

 

Taizhou Volsen Chemical Co., Ltd. is professional in R&D, producing and marketing Pharmaceutical raw materials, pharmaceutical intermediates in China. VOLSEN consists of about 100 experienced employees including 3 PhD and 10 Master, and 35000 sqm facilities including research laboratories, kilo lab, pilot plant and full manufacturing plant,


VOLSEN R&D specialists, quality manager and sales with abundance experience make sure products are reliable and service is professional. The producing person inspect every step of the whole process and check up the quality strictly, in order to insure every batch of raw material achieve the standard of EP,CP, JP,BP etc.Matching to the diversified requirements of companies VOLSEN is steadily marching to reach the peaks.


Volsen owns a professional custom synthesis department, with more than 15 senior scientific research chemical personnels who have a graduate degree or above. We also have an independent scientific management system. Our company integrates years of production experiences and talent reserves that forms a strong R&D production capacity, furthermore we could undertake various chemicals customizations from kg to ton relying on the existing production base and equipment.


Manufacturing Unit is equipped with a facility of progressive reeducation of emissions, effluents and discharge of waste material that are known to have a negative impact on the environment. Besides, Laboratory as well as plant is equipped with latest Machinery, Equipments, Technical personnel & Means of communications.

Due to supply of reliable quality, efficient follow up, scheduled delivery and prompt response to any matter, company wins good comments from customers.

We aimed at delivering real business value to our clients. For any interest, pls call on us or email us to get our best services.

Company Info

  • Company Name: Taizhou Volsen Chemical Co., Ltd.
  • Representative: Mr Chen
  • Product/Service: Efinaconazole Intermediates , Isavuconazole Intermediates , Obeticholic Acid Intermediates , Vilanterol Intermediates , Dolutegravir Intermediates , Umeclidinium Bromide
  • Capital (Million US $): 60000000RMB
  • Year Established: 2002
  • Total Annual Sales Volume (Million US $): Above US$100 Million
  • Export Percentage: 91% - 100%
  • Total Annual Purchase Volume (Million US $): Below US$1 Million
  • No. of Production Lines: 5
  • No. of R&D Staff: 91 -100 People
  • No. of QC Staff: 11 -20 People
  • OEM Services Provided: yes
  • Factory Size (Sq.meters): 30,000-50,000 square meters
  • Factory Location: Dongying Economic Development Zone , Dongying, Shandong,China
  • Contact Person: Ms. Amy Cheng
  • Tel: 86-576-88869393
Email to this supplier
  • *Subject:
  • To:

  • *Messages:
    Your message must be between 20-8000 characters