High Purity 98% Human Growth Hormone Peptide GLP-1 CAS 106612-94-6
| Payment Type: | T/T |
|---|---|
| Terms of Trade: | CIF |
| Min. Order: | 1 Kilogram |
| Delivery Time: | 15 Days |
| Packaging: | AS REQUIRED |
|---|---|
| Productivity: | KGS |
| Brand: | VOLSENCHEM |
| Transportation: | Air |
| Place of Origin: | CHINA |
| Supply Ability: | TRUE MANUFACTURER |
| Certificate: | GMP Peptide |
Basic Info
Model No.: 106612-94-6
Product Description
Cas No.: 106612-94-6
Synonyms: PROGLUCAGON (78-108) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);PREPROGLUCAGON 78-108 HUMAN;PREPROGLUCAGON (98-128) (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);INSULINOTROPIN (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG;GLP-1 (HUMAN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG)
Molecular Formula: C151H228N40O47
Molecular Weight: 3355.67
Purity: ≥98%
Packing: Export worthy packing
Material Safety Data Sheet: Available on request
Usage: used as a paracrine hormone involved in the inhibition of glucagon
Taizhou Volsen Chemical Co., Ltd.
Taizhou Volsen Chemical Co., Ltd. is professional in R&D, producing and marketing Pharmaceutical raw materials, pharmaceutical intermediates in China. VOLSEN consists of about 100 experienced employees including 3 PhD and 10 Master, and 35000 sqm facilities including research laboratories, kilo lab, pilot plant and full manufacturing plant,
VOLSEN R&D specialists, quality manager and sales with abundance experience make sure products are reliable and service is professional. The producing person inspect every step of the whole process and check up the quality strictly, in order to insure every batch of raw material achieve the standard of EP,CP, JP,BP etc.Matching to the diversified requirements of companies VOLSEN is steadily marching to reach the peaks.
Volsen owns a professional custom synthesis department, with more than 15 senior scientific research chemical personnels who have a graduate degree or above. We also have an independent scientific management system. Our company integrates years of production experiences and talent reserves that forms a strong R&D production capacity, furthermore we could undertake various chemicals customizations from kg to ton relying on the existing production base and equipment.
Manufacturing Unit is equipped with a facility of progressive reeducation of emissions, effluents and discharge of waste material that are known to have a negative impact on the environment. Besides, Laboratory as well as plant is equipped with latest Machinery, Equipments, Technical personnel & Means of communications.
Due to supply of reliable quality, efficient follow up, scheduled delivery and prompt response to any matter, company wins good comments from customers.
We aimed at delivering real business value to our clients. For any interest, pls call on us or email us to get our best services.
Company Info
- Company Name: Taizhou Volsen Chemical Co., Ltd.
- Representative: Mr Chen
- Product/Service: Favipiravir Intermediates , Arbidol Intermediates , Relugolix Intermediates , Vilanterol Intermediates , Remdesivir Intermediates , Umeclidinium Bromide
- Capital (Million US $): 60000000RMB
- Year Established: 2002
- Total Annual Sales Volume (Million US $): Above US$100 Million
- Export Percentage: 91% - 100%
- Total Annual Purchase Volume (Million US $): Below US$1 Million
- No. of Production Lines: 5
- No. of R&D Staff: 91 -100 People
- No. of QC Staff: 11 -20 People
- OEM Services Provided: yes
- Factory Size (Sq.meters): 30,000-50,000 square meters
- Factory Location: Dongying Economic Development Zone , Dongying, Shandong,China
- Contact Person: Ms. Amy Cheng
- Tel: 86-576-88869393
Premium Related Products
Other Products
