Pharmaceutical Peptide Peptide Cjc-1295 Dac, Cjc-1295 Without Dac
Basic Info
Model No.: API
Product Description
Model NO.: API Customized: Customized Suitable for: Adult Purity: >98% Mf: C159h258n46o45 Appearance: White Powder Type: Pharmaceutical Intermediates Shelf Life: 2 Years Transport Package: Box Origin: Shanghai Powder: Yes Certification: GMP, HSE, ISO 9001, USP, BP State: Solid CAS No: 863288-34-0 Other Names: Cjc1295 Place of Origin: Shang Hai China (Mainland) The Purity: Over 98% Shipping Method: FedEx, DHL, EMS or by Air Specification: g Pharmaceutical Peptide Peptide CJC-1295 dac, CJC-1295 without dac
Quick Details
Description
CJC1295 is a tetrasubstituted peptide of 29 Amino Acid length, primarily functioning as a releasing hormone (GHRH) analog. It was invented by a Canadian biotechnology company. CJC1295 is a synthetic human GHRH analog that binds to endogenous albumin after subcutaneous administration, extending its half-life and therapeutic window.
Standard: Medicine Grade
Storage: Lyophilized CJC1295 W/O DAC is stable at room temperature for 90 days, however it should be stored in a freezer below -8C for any extended period of time. After reconstituting CJC1295 W/O DAC should be refrigerated at temperatures not to exceed 36 F.
Source: Chemical Synthesis
Storage: Lyophilized CJC-1295 W/O DAC is stable at room temperature for 90 days, however it should be stored in a freezer below -8C for any extended period of time. After reconstituting CJC1295 W/O DAC should be refrigerated at temperatures not to exceed 36 F. Contact us if you need more details on Peptides. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Pharmaceutical Intermediate、Amino Acid. If these products fail to match your need, please contact us and we would like to provide relevant information.
Quick Details
| CAS No.: | 863288-34-0 | Other Names: | CJC-1295 Acetate | MF: | C159H258N46O45 |
| EINECS No.: | --- | Place of Origin: | Shanghai, China (Mainland) | Type: | Immune Function Agents |
| Grade Standard: | Medicine Grade | Usage: | Animal Pharmaceuticals | ||
| Model Number: | -- | Purity: | 99%min, 99%, 98% | Name: | cjc1295 dac |
| Packing: | 1 Box/Boxes | apperance: | White Powder | documents available: | COA |
| Certification: | ISO |
Description
| Product Name: | CJC1295 |
| Synonyms: | CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide;CJC-1295 Acetate;CJC1295 with out DAC |
| CAS: | 863288-34-0 |
| MF: | C159H258N46O45 |
| MW: | 3649.30 |
| EINECS: | -- |
| Product Categories: | Peptides |
| Purity: | 99%,98% |
CJC1295 is a tetrasubstituted peptide of 29 Amino Acid length, primarily functioning as a releasing hormone (GHRH) analog. It was invented by a Canadian biotechnology company. CJC1295 is a synthetic human GHRH analog that binds to endogenous albumin after subcutaneous administration, extending its half-life and therapeutic window.
Standard: Medicine Grade
Storage: Lyophilized CJC1295 W/O DAC is stable at room temperature for 90 days, however it should be stored in a freezer below -8C for any extended period of time. After reconstituting CJC1295 W/O DAC should be refrigerated at temperatures not to exceed 36 F.
Source: Chemical Synthesis
Storage: Lyophilized CJC-1295 W/O DAC is stable at room temperature for 90 days, however it should be stored in a freezer below -8C for any extended period of time. After reconstituting CJC1295 W/O DAC should be refrigerated at temperatures not to exceed 36 F. Contact us if you need more details on Peptides. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Pharmaceutical Intermediate、Amino Acid. If these products fail to match your need, please contact us and we would like to provide relevant information.
Product Categories : Pharmaceutical Peptides
Other Products
Hot Products
Pharmaceutical Peptides Over 98% CAS 77591-33-4 2mg/Vial Thymosin Beta 4 /Tb500Lab Supply GMP Certified Bcp-157 CAS: 137525-51-0 at Hot SaleRaw Powder Deslorelin Acetate for Adult with GMP ApprovedGood Resouce Lanreotide with Raw Powder2016 Hot Sale Factory Price Fast Delivery Pharmaceutical Peptide Melanotan 2 CAS 121062-08-6Selank Lab Supply High Purity 98% Peptides Selank for Research with GMPHigh Quality PT-141 32780-32-8 Peptide for Sexual DysfunctionHigh Purity Carperitide 89213-87-6 with Best PriceGonadorelin Acetate 99%Purity Peptide, Gonadorelin PriceHigh Purity Gh 176-191 for Muscle Growth with GMP (10iu/vial)(Dispel freckle and whiten skin) Peptide Tetrapeptide-30 with GMP CAS 56-81-5Peptide Supply Peptide Product Ghrp6, Top Grade Ghrp6 - Buy Peptide Hormone, CAS 87616-84-0Hot Sale Cjc-1295 for Bodybuilding with GMP SGS (with DAS)Pharmaceutical Intermediate Peptides for Loss Weight 1mg/Vial Igf-1lr3 / MgfResearch Chemical Peptide Ghrp-2 Supplier From ChinaPharmaceutical Peptide Build Muscle/Loss Weight 5mg/Vial Ghrp-2 with Lab Supply