Glucagon Hydrochloride, 16941-32-5, Supply Glucagon Powder

Model NO.: API Customized: Customized Suitable for: Adult Purity: >98% Color: White Type: Vitamins, Amino Acids and Coenzyme Packaging Details: 2mg/Vial 1mg/Vial Specification: 2mg/vial HS Code: 2901291000 Powder: Yes Certification: GMP, HSE, ISO 9001, USP, BP State: Solid Appearence: Blue Powder Grade: Medicine Grade Application: Used Trademark: Filter Origin: Shang Hai Product Name: Glucagon Acetate
 
 

Product Name:	Glucagon
Synonyms:	GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;OXYNTOMODULIN (PORCINE);OXYNTOMODULIN
CAS:	16941-32-5
MF:	C153H225N43O49S
MW:	3482.75
EINECS:	232-708-2
Product Categories:	Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research
Purity:	98%.99%
Molecular structure

 
 
 
What is Glucagon Acetate ?
 
Glucagon is a Peptide Hormone, produced by alpha cells of the pancreas, that raises the concentration of glucose in the bloodstream. Its effect is opposite that of insulin, which lowers the glucose concentration.The pancreas releases glucagon when the concentration of glucose in the bloodstream falls too low. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream. High blood glucose levels stimulate the release of insulin. Insulin allows glucose to be taken up and used by insulin-dependent tissues. Thus, glucagon and insulin are part of a feedback system that keeps blood glucose levels at a stable level. Glucagon belongs to a family of several other related hormones.
 



 

1g,5g,10g,50g,100g/bottle.
1kg/tin for trial order.
25kg/drum for commercial quantity.
Specific packing required by customer.
We are the direct factory which is located in zhengzhou, Henan province. We also specialize in  the research, development and production of kinds of Amino Acids,Pharmaceutical Polypeptide,Comestic Polypeptide,Vetenary Peptide and Pharmaceutical APIs. We provide good quality and best price with professinal technique.
 
1.COA HPLC MS be sent on request
2.A-Grade 
3.competitive price 
4.Fast delivery
 
 
 1)Delivery: Immediately by DHL/EMS/TNT within 10 days (If you have Forwarder in China,
 
the better.) 
 
 2)  Payment Terms: T/T or western union 
 
 
Please feel free to contact us if you have any other requirement, we accept custom-made.Most competitive price, best quality and best service will be provided.
 
 
  
 
T:008615294859659

Contact us if you need more details on Glucagon Hydrochloride. We are ready to answer your questions on packaging, logistics, certification or any other aspects about Pharmaceutical Intermediate、Amino Acid. If these products fail to match your need, please contact us and we would like to provide relevant information.

Product Categories : Pharmaceutical Peptides